Shop SoundAndVision
Refine By

Mpow

  • Sort By:
Mpow

simple and easy wireless set up automatically connect if you need the cell phone connect the receiver automatically just turn on t...he bluetooth of the cell phone first and then turn on the bluetooth receiver read more

Mpow
¤17.99 ¤19.99-¤17.99
at Amazon.com

<b>Just enjoy a crystal clear sound wirelessly</b><br><br> Mpow Portable Wireless Bluetooth Receiver is designed to provide a simp...le hands-free solution for answering and receiving phone calls while on the go. We upgrade the product to make the product more smart. Just simple operation, normal car speaker become hands-free Bluetooth speaker magically, portable for vehicle mounted systems. <br><br> <b>Wide Compatibility</b><br><br> Works with iPhone, iPod, iPad, Android Smartphones, Tablets, and other Bluetooth devices, just plug into any powered Car & Home Stereo Audio System or Speakers via the 3.5 mm audio cable/adapter. <br><br> <b>Specification</b><br><br> Wireless Version: CSR V4.0; <br> Wireless Range: Up to 33 feet; <br> Charge time: 1.5 hours; <br> Playing time: Up to 10 hours; <br> Standby Time: 120 hours; <br><br> <b>Packing List</b><br><br> 1x Portable Bluetooth Receiver; <br> 1x Micro USB charging cable; <br> 1x 3.5mm audio connector; <br> 1x 3.5mm audio Cable; <br> 1x User Manual; <br><br> <b>Warranty </b><br><br> Every Mpow product includes a 45 days refund & 18 month worry-free! read more

Mpow

bluetooth 4.1 adopts bluetooth 4.1 this headphones connect to your phone or tablet up to 32 feet while ensuring robust and clear s...ound comfortable fit with ergonomic design and soft silicone ear hook this in ear bluetooth headphone fits... read more

Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Mpow
¤31.99-¤11.99
at Amazon.com

Designed for SportsThe stylish wireless back head design is made for sports enthusiasts. It?s time to free yourself from those ent...angled/coiled long lines !Great SoundCSR 8645 chip, aptX technology, surrounded stereo sound are all built in Mpow Seashell just for creating excellent music and movie experience.Noise CancellationThe 6th generation CVC technology reduces outside noises and enables clearer sound from microphone. You can get high quality, hands-free phone conversation even on the street or inside the shopping mall.WarrantyEvery Mpow Product includes a 45 days money back & 18-month worry-free! read more

Mpow

<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters... out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. Noise cancelling microphone further guarantees clear sound for hands-free calls.</p> <p><b>Wireless Freedom</b></p> <p>With a battery life of 8 hours continuous wireless playback, our product won't let you down. However, if you do find yourself unable to recharge, you have the option of using the included audio cable(Wired mode without microphone). The headphone is optimized for portable audio including mp3, CD players, iPad, iPod iPhone, and other Bluetooth mobile devices.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes the headphone easy to take along on vacation or business trip. You can store it in your bag for use at work when you need to focus. </p> <p><b>Wearing Comfort</b></p> <p>Super soft ear cushions help lock your ear snugly and the ultra-light weight of the overhead headphone does not cause any burden to the ears, thus providing lasting wearing comfort.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

Mpow
¤7.49 ¤9.99-¤7.49
at Amazon.com

High Fidelity Sound High performance speaker ensures extended frequency range. Enhance the bass and crisp high so that you can fu...lly enjoy the distinct and natural sound. Effortless to Use With extremely flexible tangle-free cable including inline controller, you can control the calls and music via the multifunctional button. Short press to play, pause music or answer a call. Long press to reject or end a call. Built-in microphone makes you free to chat with your friends or listening to music for leisure, running, jogging and etc. Easy to Carry The additional spring-loaded clip can be attached to your shirt collar or jackets for fixing the wire and convenient carrying. Therefore, you are no longer worried about losing your headphones while you take out the headphones from your ears and wear around your neck. Specifications: Frequency Response: 20Hz-20 KHz Impedance: 32?±15% Plug: 3.5mm Gold-plated Plug Cord Length: 1.2m±0.05m (3.9ft±0.2ft) Package Included: 1×In-ear Headphones 3×Different Sizes Ear Tips (Small/Medium/Big) 1×Clip read more

Mpow

Steps for Locating Your Car 1) Turn on the GPS/NET/Bluetooth of your phone 2) Turn on the Car Locating Bluetooth 3) Turn on the Ap...p downloaded from the user manual 4) Turn off the Car Locating Bluetooth to locate 5) Follow the direction or the GPS Map to find your love car read more

Mpow

<p> <strong>Just pull Mpow out from your pocket,then snap.</strong> </p> <p> <strong>One-piece Design, More Portable.</strong> </p...> <p> This latest Bluetooth Self-portrait Monopod, Mpow iSnap X, features the one-piece design, no bother to install the product piece by piece. And this product is the most mini selfie stick in the market, which makes it perfectly convenient and portable to be incorporated in your bags or even pocket! </p> <p> <strong>U-shape Clamp, Smaller and Tighter.</strong> </p> <p> The ingenious U-shape clamp design brings more advantages to its users. First?this U-shape clamp makes itself smaller ,does not take much space. Second, this rotatable U-shape clamp can just roll over and let the stick in the U space, which makes the stick look even more tiny and shorter. Another point is that the protective silicone material of the clamp enhancing its surface friction, this, will help clamp your phones more tightly. </p> <p> <strong>One Short Click to Snap Your Picture.</strong> </p> <p> When you want to snap your picture, just click the camera button shortly and lightly, you will feel a strong feedback force, and this will bring a good using experience to you. </p> <p> <strong>Perfect Holding Feeling.</strong> </p> <p> The exquisite handlebar of the selfie stick gives you a perfect holding feeling due to its matte surface. When holding in hand, you feel soft in hard, while clingy as well,so the monopod won?t fall off your hand. </p> <p> <strong>IOS/Android Compatible.</strong> </p> <p> It matches most IOS/Android phones, so you do not need to worry about the no connecting thing! </p> <p> <strong>World Famous Warranty</strong> </p> <p> At MPOW, we back them all with an 18-month warranty & 45 days money back and provide friendly, easy-to-reach support,and Free Lifetime Technical Support also. </p> read more

Mpow
¤28.99-¤17.99
at Amazon.com

Wireless Sport Headphones Specially designed for sports enthusiast, the perfect music partner for sports and running. Robust & D...ynamic Sound Adopt Bluetooth 4.1, this sports headphone offers incredible sound quality with deep extremely deep, distortion-free bass and truer sounds and delivers stable and strong signal than the general Bluetooth headset in a 32-feet working distance. Handsfree Function This Bluetooth headset can provide the true hands-free convenience and exceptional ease-of-use, so that you you can get hands-free phone conversation with clear voice even in noisy environment like inside a gym and running/cycling on the road. Metal-constructed Shell Featured with exquisite metal-constructed shell, this in-ear headphones is well-designed and high-end that can create the metal sound chamber. Multipoint Function The three smart button in-line control with microphone allows you conveniently control your music-playing options and answer or end calls. Package Includes: 1 x Mpow Coach Bluetooth Sport Headphone 3 x Ear Tips(Small, Medium, Large) 1 x Micro USB Charge Cable 3 x Indoor Leisure Fit Ear Hooks 3 x Outdoor Sport Fit Ear Hooks 1 x User Manual read more

Mpow

<b>Features</b><br><br>1. Provides hands-free calling through car speakers, set free your hands during driving.<br>2. USB Charging... Port, 5V/2.1A car charger can charges your favorite mobile devices fast, and it can automatically adjust the outputpower to different smart phone.<br>3. Large 1.44 inch LED Display Screen, enable to show you the current voltage of the storage battery of your car, the name of songs or caller ID.<br>4. Auto-Connect, pair once only, auto-connect next time if your phone??s Bluetooth is turned on first.<br>5. Gooseneck Design, the flexible metal hose is designed to be goose neck shape, which allows you to adjust its direction conveniently.<br><br><b>Specifications</b><br><br>Bluetooth Version: V3.0 + EDR;<br>Effective Bluetooth Range: 10 meters;<br>FM Frequency: 87.5MHz - 108.0MHZ;<br>Working Voltage: 10V~24V;<br>Audio Input /Output: 3.5mm audio interface;<br>USB Charging Port: 5V/2.1A.<br><br><b>NOTE</b><br><br>1.This FM transmitter is compatible with most cars, but not all. Please ensure your car space is big enough to accommodate this car kit;<br>2.To prolong the lifespan of this product, please do not violently rotate the head of this product when you use it (the rotation angle shall not exceed 90 degree) ;<br>3.For the best sound quality, please tune it to an unused frequency; if there is interference when listening to music, please tune to another unused frequency;<br>4.The max output current of the transmitter varies with charged devices, because charged devices can limit output current automatically. The input current also varies with charged devices, lower the power, larger the input;<br> 5.If you want to change the way to play music, please pause the music first and then try another mode to play.<br><br><b>Package Included: </b><br><br>1x Bluetooth FM transmitter;<br>1x User Manual;<br>1x Audio Cable(3ft);<br><br><b>Warranty</b><br><br>Every Mpow Product includes a 45 Day refund, 18-month worry-free Guarantee! read more

Mpow
¤32.99-¤9.68
at Amazon.com

Innovative Button System Instead of complicated button system, we rearrange the layout of buttons by deleting the unnecessary volu...me control button and put several function keys into just one protruding button. So the exsisting buttons can truly reach the effect of operating without get your head down ! Perfect for Calls & Music The Mpow Flex also has a built-in microphone with voice detection, so every conversation comes out clear.Or you can sync the Flex to your BT device and then enjoy clear music experience.What's more, if your BT device is nearly powered off, you can charge it via the 2.1A Car Chager Port ,which again can ensure non-stop music playing ! Top-notched Quality As for the craftsmanship, We have been following through the process of the design, manufacture production for nearly two years .We select the industry-level components for Mpow Flex ,thus a higher quality Flex is born ! For Fashion Lifestyle We always keep pace with times, so we added Siri/Voice Command to Flex ,you can just click the sided button to activate it. The silver metallic screen is also fantastic and fabulous to be a perfect-match to your exquiste life ! Wide Compatibility Mpow Flex Works perfect for Apple , Samsung , HTC , LG , Sony , Motorola , Nokia & More Smartphones , Tablets & MP3 Players and more.So no need to worry the no connecting thing ,it works ! Specifications Bluetooth Version: 4.0 Full Frequency : 87.5~108 MHz FM Operating Distance : ? 10M Input Power : 12 V USB Output Power : 5.5V 2.5A max Noise-signal Radio : -82dB Warranty Every Mpow Product includes a 45 days money back & 18-month worry-free Guarantee! read more

Mpow
¤79.99-¤36.99
at Amazon.com

Immersive Hi-Fi Sound Designed for an excellent listening experience, Mpow Bluetooth headset with CSR chip and around-ear cushion ...design can provide robust, immersive and Hi-fidelity sound. Advanced Compatibility The Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV. Foldable and Portable Design The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. Dual mode: Wireless & Wired In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; In the wired mode: Used as a wired headphone with an audio cable. Note: 1. Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. 2. The microphone only works in the wireless mode. Specification Bluetooth Version: 4.0 Range: 33 feet (10 meters) Talking Time: Around 15 hours Playback Time: Around 13 hours Charging Time: 4 hours Charging Voltage: 5V Battery Capacity: 420mAh Packing List 1x Mpow Bluetooth Headset 1x 3.5mm Audio Cable 1x USB Charging Cable 1x Packing Bag 1x User Manual Warranty Every Mpow product includes a 45-day money back & 18-month warranty. read more

Mpow
¤45.99-¤20.99
at Amazon.com

Bring Music Where You SweatThanks to the IPX7 sweatproof rating, Mpow sports earbuds keeps the headphones protected and in peak co...ndition whether you're getting drenched in sweat after a grueling workout.Hear Richer Sound in The Right WayDifferrent people like different audio styles(someone favor bass, mid, or high), and have different Ear sensitivity, what we can do is to make as richer as possible audio range for you: We tuned this bluetooth headphones especially the bass part which is the chief lack for most in-ear earbuds, Hence, you can get more balanced sound with warm bass except for the Bluetooth distortion, If there is any sound loss, you can readjust it to fit your ears more tightly to get richer levels. Always Stay ComfortableErgonomic and shallow in-ear design, soft silicone ear hooks, and memory foam ear tips brings secure fit without hurting your ears, enables comfortable wearing experience.Portable Gym-ready Carrying Pouch & Cord clip Come with an EVA bag with cushioned interior which allows you to store your earbuds safely and prevent the scratches in your training routine, The cord clip can shorten the wire to fit your back neck or head, beacouse the long wire may bother your move and cause stethoscope effect.Note:(1) Please keep your headphone charged when in low battery to achieve better Bluetooth connection and battery protection.(2) Please choose suitable ear tips and wear your headphone tightly when you are running or cycling, it will help you reduce annoying wind noise as much as possible.Be Safer in Less Noise Isolation:The shallow in-ear design is not only for comfy wearing but also for your safety on the move, it won't blocks all the environment noises to keep you more aware of the surrounding, which is more suitable for sports like running, cycling or hands-free talk in the work.If you want to block some unwanted noises: you can push the earbuds deeper inside your ears canal or turn up your music.Specifications:Bluetooth Standard: V4.1Wireless Profile: Headset, Handsfree, A2DP, AVRCPOperating Range: 10m(33ft)Standby Time: 220hrsCharging Time: 1.5hrsTalk /Playing Time: 7hrsCharging Voltage: DC 5VBattery Capacity: 100mAh/3.7VPackage Contents:Mpow Earphone× 1 Regular Ear Tips(S,M,L) × 3 Pairs Memory Foam Ear Tips× 1 Pair Cord clip × 1EVA Carrying Case× 1 Charging Cable× 1 read more

Mpow
¤27.69-¤18.69
at Amazon.com

What Mpow Updates This is the 4th generation of Mpow Lens, and this time we bring you the best phones lens Mpow has ever made. Fis...heye Lens effect becomes striking; 0.36X Wide Angle Lens shoot wider views compared to the previous 0.67X one; What's more, the extra bonus,20X Macro Lens has also been updated compared to the other 10X ones in the market, thus you get more details in your photos. Supreme Fisheye Lens Features: 180 degree of the scene can be captured by Fisheye lens, which takes you into a stunning fantastic world. Angle: 180 degree Magnification: 0.33X Note: Before using,it is suggested that the case of your smartphone be removed and the lens should be adjusted right in front of the camera lens of your smart phones, for avoiding some blurring photos. Wide-angle Lens Features: Wide-angle lens can shoot larger range of scenery. Magnification: 0.36X Note: When shooting pictures, it is suggested that the Wide-angle Lens be used in a wide-open area in order to get a great difference. Macro Lens Features: Macro lens can take clear photos of small objects. Magnification: 20X Note:In order to get a stunning effect when using this macro lens, you need to place the transparent cap on the surface of objects you want to shoot. Warranty Every Mpow Product includes a 45 days money back & 18-month worry-free! read more

Mpow

<p><b>Stereo Hi-Fi Sound</b></p> <p>Designed for an excellent music & communication experience, Mpow headset adopts the best CSR c...hip together with CVC6.0 noise cancelling technology for isolating outside noise, providing rich and dynamic audio. </p> <p><b>Advanced Compatibility</b></p> <p>The Bluetooth headset can easily and quickly connected with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. </p> <p><b>Dual mode: Wireless & Wired</b></p> <p>In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; In the wired mode: Used as a wired headphone with an audio cable.</p> <p><b>Note: </b></p> <p>1.Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. <br> 2.Microphone only works in the wireless mode. </p> <p><b>Specification</b></p> <p>Bluetooth Version: 4.0<br> Range: 33 feet (10 meters)<br> Talking Time: Around 15 hours<br> Playback Time: Around 13 hours<br> Charging Time: 4 hours<br> Charging Voltage: 5V<br> Battery Capacity: 420mAh<br> </p> <p><b>Packing List</b></p> <p>1x Mpow Bluetooth Headset<br> 1x 3.5mm Audio Cable<br> 1x USB Charging Cable<br> 1x Packing Bag<br> 1x User Manual<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45-day money back & 18-month warranty.</p> read more

Mpow
¤23.99-¤18.99
at Amazon.com

Compact Size, Powerful PerformanceMini lightweight build to easily stored and take on your travel. Easy to pair and compatible wit...h most smartphones and bluetooth devices that allows you wirelessly stream music through home or vehicle audio systems. Bluetooth Version 4.1Compared to earlier or older versions like Bluetooth V3.0 or V4.0, this wireless audio receiver with Bluetooth V4.1 consumes much less energy and lasts much longer. Bluetooth range reach up to 33 feet in open space.Long Battery LifeWith up to 18 hours of playing time, or 140 hours on standby mode, you will have plenty of power to last even the longest family road trips or daily use. A quick 3 hour full re-charge time will make it powered and ready to go at will.Universal compatibilityBluetooth 4.1 Receiver compatibles with most smartphones and Bluetooth electronics; ideal for home or vehicle audio systems. WarrantyEvery Mpow Product includes a 45 days money back & 18-month worry-free guarantee! read more

Mpow
¤56.99-¤31.99
at Amazon.com

Mpow Bluetooth 4.1 Transmitter/Receiver ---- Match Your Smart Life! Mpow 2 in 1 has a mini and protable body and is designed to c...onvenient your life for which could be easily and quickly connect with your Bluetooth devices within 33 feet.If you are annoyed with the wired devices, Mpow will save you from the mess and simplify. RX Mode (Receiver Mode) : 1. Connect the device to your non Bluetooth headphone/home speakers or car stereo system with 3.5mm audio cable. 2. Pair the receiver to your smart device. 3. Now you can enjoy your music through your headphone, speakers, home stereo system/car stereo system, or answer hands free calls. TX Mode (Transmitter Mode): 1. Pair the device to your Bluetooth headphones or Bluetooth Speakers. 2. Plug it in your non-Bluetooth media devices (such as MP3, CD/DVD player, TVs, etc.) via 3.5mm audio cable or RCA cable. 3. Now you can enjoy your music via Bluetooth speakers/Bluetooth headsets from your non-Bluetooth media device! Voice Assistant: Long press button ?+? and ?-? simultaneously for 1 second, you could trigger the ?voice assistant function? of your phone, and repeat the procedure to close. Specifications: Specification Bluetooth Version: 4.1 Frequency Range: 2.4GHz Output Power Category: Class 2 Bluetooth Mode: HFP/HSP/A2DP/AVRCP Bluetooth Range: Up to 33 feet Battery: 180mAh Working Current: 15mA (MAX) Charge Voltage: DC 5.0V Packing List: 1 x Bluetooth Receiver and Transmitter 1 x Charging Cable 1 x 3.5mm Audio Cable 1 x 3.5mm Audio Adapter 1 x RCA Cable 1 x User Manual Warranty: The product includes a 45 days money back & 18-month warranty. read more

Mpow
¤32.99-¤18.99
at Amazon.com

Mpow Bluetooth 4.1 Receiver with Car Locator -- Mpow Smart Your LifeSteps for Locating Your Car:1)Turn on the GPS/NET/Bluetooth of... your phone 2)Turn on the Car Locating Bluetooth3)Turn on the App downloaded from the user manual4)Turn off the Car Locating Bluetooth to locate5)Follow the direction or the GPS Map to find your love carMake Your Wired Speaker & Headphone Wireless:Upgrade your wired speakers,home stereo,or wired headphones with Bluetooth technology,and free from the tangle of audio cables. Stream your favorite music wirelessly to stereo systems in your car or at home.Wireless Freedom with Endless Fun:The Bluetooth car kit adapts latest Bluetooth 4.1 technology for wireless audio streaming. Enjoy up to 11 hours of continuous audio play and 90 hours car locating time without having to recharge adapter.Notes:1.On Car Locating Mode, the receiver can NOT connect two devices at the same time.2.The Car Locating Function works on both iOS and Android devices via Bluetooth,can locate simultaneously on iOS devices,but may have a 5-20's locating delay on different Andriod devices.Specifications:Bluetooth Version:V4.1Frequency Range:2.4GHzOutput Power Category:Class 2Bluetooth Mode:HFP/HSP/A2DP/AVRCPBluetooth Range:up to 30 feetPower Supply:Li-Po 180mAhBluetooth Receiver Operating Time:about 11 hoursCar Locator Operating Time: about 90 hoursCharge Voltage:DC 5.0VAttention:Please use 5V standard charger to charge Mpow.Do not use quick charger/ flash charger/ fast charger for the output voltage is over 5V and may destroy your Mpow.Package Included: Bluetooth Receiver and Car Locator× 13.5mm Audio Cable× 13.5 mm Metal Audio Adapter× 1User Manual× 1Warranty:Every Mpow product includes a 45-day money back & 18-month warranty. read more

Mpow

Record Underwater Moments The IPX8 rated waterproof phone case provide all-round protection for your cellphones, allowing you take... photos or videos under the sea, helping you record every cherish moment.Unhindered View While your phone is enclosed in a waterproof case, it doesn't mean that it can't be accessible. Mpow waterproof phone case enables you actually use your phone while in the pouch, such as swiping through screens, taking photos, etc.Universal Size & Multiple Uses Compatible with most smart phones (under 6 inches) including iPhone 7, 7 Plus, iPhone 6s, 6s Plus, iPhone 6, Nexus 6, 6P, 5, 4, Sony Xperia Z3, Z2, Z1, LG G6, Google pixel, HTC M10 etc. Also act as another pocket for you to put your credit card, cash or passport, protecting your valuables from water and dirt.Enjoy the FunWe believe that the protection for your phone should not limited by weather. Whether you are diving, boating or skiing, this waterproof case gives your cellphone most intimate care. No more worrying about dropping your phone in the snow or water, just enjoy the fun that Mpow brings.Notes: 1. Pease conduct a safety test before using the product. Simply put a tissue inside the bag and drop it into the water for 30 minutes, then take it out to check if the tissue is wet or not. DO NOT use the product if the tissue is wet.2. Tips on using this item: First, Release the snap closure after passing the safety test. Second, open the case gently. Third, put your smartphone into it softly. Fourth, close the seal smoothly, please make sure you?ve pressed the top of case inside the seal completely. 3. The pressure in depth may impact touchscreen actions, please use the volume buttons to take photos if this happens. 4. The transparent waterproof bag allows you to unlock the HOME button of your iPhone 7 & 7, but not for Touch ID fingerprints. read more

Mpow
¤79.99-¤37.99
at Amazon.com

Advanced CompatibilityThe Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devi...ces within 33 feet. THOUGH, according to the results of Mpow consumer surveys for three years, 99% issues about Bluetooth connection from the customers' feedback are due to their misunderstanding and improper operation which can always be solved easily after the personalized guidance, Thus:1. If you can't connect this headphones to your cell phones or other devices, please ask us for a complete FAQ guidance of Bluetooth Headphones, you can find the solutions finally!2. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV. Dual mode: Wireless & Wiredthe wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; the wired mode: Used as a wired headphone with an audio cable.Note:1. Firstly, The ear cushions(inner diameter:1.3~3.3 inches) are designed as over-ear, not on-ear. Feeling like "on-ear" or "not over-ear enough "only depends on your ear size/shape. Secondly, please keep the headset in dry and cool environment as the ear cushion is made of memory-protein materials.2. The microphone only works in the wireless mode.3. Depending on your head/ear size/shape, this headphones may be a little tight(feels like "on-ear") for someone which is designed to avoid sound leakage.In case of that and to get both audio and wearing comfort, please take off the headphone every 1-2 hrs to get your ears relax and protect them from lasting muggy environment in use.Foldable and Portable Design?The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability.Specification:Bluetooth Version: 4.0Range: 33 feet (10 meters)Talking Time: Around 15 hoursPlayback Time: Around 13 hoursCharging Time: 4 hoursCharging Voltage: 5VBattery Capacity: 420mAhPacking ListPacking List:1x Mpow Bluetooth Headset1x 3.5mm Audio Cable1x USB Charging Cable1x Packing Bag1x User Manual read more

Mpow
¤25.99-¤9.79
at Amazon.com

Enjoy the Freedom of Music Our FM Transmitter will transfer your tunes from your mobile phone or iPad to your car's stereo system ...quickly and easily. The product allows you to do just that by using FM radio waves to send your favorite songs, audio books, radio and whatever you love from your mobile device to a nearby FM radio. Set your hands free to enjoy the melody trip. No More Worry for Power Off The product has got you covered with an extra USB port that delivers up to 2.1A of dedicated charging current. You don't need to worry that the long journey music will get your phone power off. Intimate road friend. Convenient Use, Great Journey Simply plug the FM transmitter into the 3.5mm audio socket of your MP3, iPad, iPhone, mobile phone, or other music player. Then turn your FM radio to a clear frequency and play your digital music wirelessly with rich, full sound. Compare with Any Device The product works with all audio devices and smartphones, such as iPhone, HTC equipped with a 3.5mm audio jack and can broadcast all your favorite songs. Warranty The product includes a 45 days money back & 18-month warranty. read more

Mpow
¤16.99-¤8.99
at Amazon.com

Mpow Ground Loop Noise Isolator for your Car Audio System/Home Stereo with 3.5mm Audio Cable. Eliminating Humming Noise If you've... got your radio, iPod, MP3 player, Bluetooth receiver or similar audio equipment plugged into your car stereo with an audio cable and you're getting audio hum noise caused by ground loops, you need this isolator work together so that you can enjoy high quality music. Forget about the annoying noise! Support We value our customers very much. Please give us the opportunity to help resolve your issues, in case you have concerns or problems with your order, Please contact us for support. Package Detail 1x Mpow Ground Loop Noise Isolator; 1x 3.5mm Audio Cable; Warranty Every Mpow Product includes a 45 days money back & 18-month worry-free guarantee! read more

Mpow

<p><b>Product Description</b><br> Workout at Anywhere <br> With a carrying bag included, this resistance band set allows you to ta...ke them with you anywhere your go. No matter you are at home or in a hotel room, you can do your daily exercise wherever you want. <br> <br> <b>Multiple Exercise Ways</b><br> You can use the accessories that come with the resistance bands to exercise different muscle groups. For the basic usage, simply attach the foam handles to the resistance band to exercise your arms and back. Or you can use the door anchor together with the foam handles or the ankle straps for more exercise ways. <br> <br> <b>Designed for All Skill Levels</b><br> You can choose a resistance that you can stand by adding the resistance band. These resistance bands are differed in colors, Yellow for 10lbs, Green for 20 lbs, Red for30 lbs, Blue for 40 lbs, and Black for 50 lbs. You can group them together from 10 lbs to the max 150 lbs according to your own physical power and your skill level. <br> <br> <b>Exercise Chart Included</b><br> And an exercise chart is included in the package for user who starting new. You can follow the exercise chart to exercise your arms, thighs, legs, back and stomach for muscle building or body shaping. <br> <br> <b>Specification</b><br> stretching length<br> Max stretching length<5 meters <br> Single side stretching length<25 meters<br> Resistance to Color: <br> Yellow: 10lbs<br> Green: 20lbs<br> Red: 30lbs<br> Blue: 40lbs<br> Black: 50lbs<br> <br> <b>PACKING LISTS</b><br> Extra light resistance band(yellow)×1<br> Light resistance band(green)×1<br> Medium resitance band(red)×1<br> Heavy resitance band(blue)×1 <br> Extra heavy resistance band(black)×1<br> Foam handles×2<br> Ankle straps×2<br> Door anchor×1<br> Carrying bag×1 <br> Band guard×1 <br> <br> <b>Warranty </b><br> Every Mpow product provides a 45-day money back guarantee and 18-month warranty. </p> read more

Mpow

<p><b>Let's stretch with Cymas Resistance Bands!</b><br> <br> <b>Durable Latex Tubes </b><br> The resistance tubes are made of pre...mium rubber latex, it can withstand strong extension. <br> Durable for long time use.<br> <br> <b>5 Bands with Various Resistance </b><br> Black: 30lbs<br> Blue: 25lbs <br> Red: 20lbs<br> Green: 15lbs<br> Yellow: 10lbs<br> <br> <b>You can combine different bands together to create resistance from 10lbs to 100lbs Add Varieties to Your Workout. </b><br> A set of resistance bands comes with detachable handles to use interchangeably. The door anchor attachment and ankle straps will assist you in getting more workout varieties. Simply slip it through the crack and it will be held by a bead that is sewn into the nylon strap. When door is closed, it is way too big to get pulled back through. <br> <br> <b>Lighter and Cheaper Than Free Weights </b><br> These resistance bands are not as bulky and expensive as free weights. You can use these bands at home, in a hotel room, in the gym, at the stadium, etc. You can use these to build your muscle everywhere in your spare time. It is less expensive and cumbersome than free weights. <br> <br> <b>Specifications:</b><br> Product Purpose: Exercise<br> Resistance Bands Material: Rubber Latex<br> Resistance Band Quantity: 5 <br> <br> <b>Package included:</b><br> 5 x Resistance Bands <br> 2 x Foam Handles <br> 2 x Ankle Straps <br> 1 x Door Anchor Attachment <br> 1 x Carrying Pouch <br> 1 x Workout<br> ?</p> read more

Mpow
¤15.99-¤9.99
at Amazon.com

High Fidelity Sound High performance speaker ensures extended frequency range. Enhance the bass and crisp high so that you can fu...lly enjoy the distinct and natural sound. Effortless to Use With extremely flexible tangle-free cable including inline controller, you can control the calls and music via the multifunctional button. Short press to play, pause music or answer a call. Long press to reject or end a call. Built-in microphone makes you free to chat with your friends or listening to music for leisure, running, jogging and etc. Easy to Carry The additional spring-loaded clip can be attached to your shirt collar or jackets for fixing the wire and convenient carrying. Therefore, you are no longer worried about losing your headphones while you take out the headphones from your ears and wear around your neck. Specifications: Frequency Response: 20Hz-20 KHz Impedance: 32?±15% Plug: 3.5mm Gold-plated Plug Cord Length: 1.2m±0.05m (3.9ft±0.2ft) Package Included: 1×In-ear Headphones 3×Different Sizes Ear Tips (Small/Medium/Big) 1×Clip read more

Mpow
¤32.99-¤17.99
at Amazon.com

Features1. Provides hands-free calling through car speakers, set free your hands during driving. 2. USB Charging Port, 5V/2.1A car... charger can charges your favorite mobile devices fast, and it can automatically adjust the output power to different smart phone. 3. Large 1.44 inch LED Display Screen, enable to show you the current voltage of the storage battery of your car, the name of songs or caller ID. 4. Auto-Connect, pair once only, auto-connect next time if your phone's Bluetooth is turned on first. 5. Gooseneck Design, the flexible metal hose is designed to be goose neck shape, which allows you to adjust its direction conveniently. SpecificationsBluetooth Version: V3.0 + EDR; Effective Bluetooth Range: 10 meters; FM Frequency: 87.5MHz - 108.0MHZ; Working Voltage: 10V~24V; Audio Input /Output: 3.5mm audio interface; USB Charging Port: 5V/2.1A. NOTE1.This FM transmitter is compatible with most cars, but not all. Please ensure your car space is big enough to accommodate this car kit; 2.To prolong the lifespan of this product, please do not violently rotate the head of this product when you use it (the rotation angle shall not exceed 90 degree) ; 3.For the best sound quality, please tune it to an unused frequency; if there is interference when listening to music, please tune to another unused frequency; 4.The max output current of the transmitter varies with charged devices, because charged devices can limit output current automatically. The input current also varies with charged devices, lower the power, larger the input; 5.If you want to change the way to play music, please pause the music first and then try another mode to play. Package Included: 1x Bluetooth FM transmitter; 1x User Manual; 1x Audio Cable(3ft) ; WarrantyEvery Mpow Product includes a 45 Day refund, 18-month worry-free Guarantee! read more

Mpow

<p><b>Mpow Enchanter Bluetooth Earbuds</b></p> <p><b> </b></p> <p><b>Sound Leadership</b></p> <p>The latest Bluetooth 4.1 technolo...gy and best CSR chip provide strong signal quickly and easily connecting, giving these wireless earbuds robust stereo sound quality.</p> <p><b>Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. 3 pairs of ear cups are supplied which isolate ambient noise well when listening to music. </p> <p><b>Designed for Sports</b></p> <p>No worry for sweat out any more, the circuit board inside earphone is coated with sweat-proof and corrosion-resistant nano-material, which greatly protects sport headphones from sweat and water.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Product Specification</b></p> <p>Bluetooth Version: V4.1<br> Charging Time: ?2 hours<br> Standby Time: 400 Hours<br> Play Time: 6 Hours<br> Talk Time: 7 Hours<br> Bluetooth Profile: AVRCP/A2DP/HSP/HFP<br> Battery: 3.7V / 100mAh<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

Mpow
¤28.99-¤19.99
at Amazon.com

Please Note: About Bluetooth Connection:The Bluetooth headphone can easily and quickly connect with smartphones, tablets, TVs and ...other Bluetooth devices within 33 feet. THOUGH, according to the results of Mpow consumer surveys for three years, 99% issues about Bluetooth connection from the customers' feedback are due to their misunderstanding and improper operation which can always be solved easily after the personalized guidance, Thus: 1. If you can't connect this headphones to your cell phones or other devices, please ask us for a complete FAQ guidance of Bluetooth Headphones before judging them defective since Mpow has a strict Bluetooth standard, you can find the solutions finally!2. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV. Flexible & Lightweight Weighs only 1.3 oz in flexible and durable silicone neckband, it is light as a feather, you will be not conscious of having it on your neck, no cable tangling when in use, and just hang around your neck when not in use. Specification Bluetooth Standard: Bluetooth V4.1 Operation Range: Up to 33ft (10m) Battery: 100mAh Music Playback: Up to 6h Talk Time: Up to 6.5h Standby Time: 200h Charging Time: 1.5h Packing List 1xMpow Bluetooth Headset 1xUser Manual 1xUSB Charger Cable 3x Pairs of Ear-tips(S,M,L) Warranty Every Mpow product includes a 45 days money back & 18-month warranty. read more

Mpow
¤32.99-¤20.99
at Amazon.com

Mpow Enchanter Bluetooth EarbudsPlease Note: About Bluetooth Connection:1. If you can't connect this headphones to your devices, p...lease ask us for a complete FAQ guidance of Bluetooth Headphones before judging them defective since Mpow has a strict Bluetooth standard, you can find the solutions finally!2. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.Sound Leadership The latest Bluetooth 4.1 technology and best CSR chip provide strong signal quickly and easily connecting, giving these wireless earbuds robust stereo sound quality. Voice Clarity Featured with noise cancellation technology, the headphone intelligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. 3 pairs of ear cups are supplied which isolate ambient noise well when listening to music. Hands Free Calling Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane. Product Specification Bluetooth Version: V4.1 Charging Time: ?2 hours Standby Time: 400 Hours Play Time: 6 Hours Talk Time: 7 Hours Bluetooth Profile: AVRCP/A2DP/HSP/HFP Battery: 3.7V / 100mAh Warranty Every Mpow product includes a 45 days money back & 18-month warranty. read more

Mpow
¤49.99-¤30.99
at Amazon.com

Mpow Bluetooth 4.1 Transmitter/Receiver ---- Match Your Smart Life! Mpow 2 in 1 has a mini and protable body and is designed to c...onvenient your life for which could be easily and quickly connect with your Bluetooth devices within 33 feet.If you are annoyed with the wired devices, Mpow will save you from the mess and simplify. RX Mode (Receiver Mode) : 1. Connect the device to your non Bluetooth headphone/home speakers or car stereo system with 3.5mm audio cable. 2. Pair the receiver to your smart device. 3. Now you can enjoy your music through your headphone, speakers, home stereo system/car stereo system, or answer hands free calls. TX Mode (Transmitter Mode): 1. Pair the device to your Bluetooth headphones or Bluetooth Speakers. 2. Plug it in your non-Bluetooth media devices (such as MP3, CD/DVD player, TVs, etc.) via 3.5mm audio cable or RCA cable. 3. Now you can enjoy your music via Bluetooth speakers/Bluetooth headsets from your non-Bluetooth media device! Voice Assistant: Long press button ?+? and ?-? simultaneously for 1 second, you could trigger the ?voice assistant function? of your phone, and repeat the procedure to close. Specifications: Specification Bluetooth Version: 4.1 Frequency Range: 2.4GHz Output Power Category: Class 2 Bluetooth Mode: HFP/HSP/A2DP/AVRCP Bluetooth Range: Up to 33 feet Battery: 180mAh Working Current: 15mA (MAX) Charge Voltage: DC 5.0V Packing List: 1 x Bluetooth Receiver and Transmitter 1 x Charging Cable 1 x 3.5mm Audio Cable 1 x 3.5mm Audio Adapter 1 x RCA Cable 1 x User Manual Warranty: The product includes a 45 days money back & 18-month warranty. read more

Mpow
¤45.99-¤26.99
at Amazon.com

Keep Your Eyes Ahead Get turn-by-turn directions to your destination for easy viewing while driving. Our HUD (Head-Up Display) rec...eives navigation information from your smartphone and projects it onto a transparent film on your windshield or an attached reflector lens. Super easy to use MPOW HUD Glass! Step 1: Use any smartphone to start any app that supports HUD mode; Step 2: Place your smartphone on a cradle with its display up; Step 3: You are all set to go! Advanced Display Technology The advanced transparent head-up display (HUD) system projects useful information directly onto the windscreen and into the driver's field of vision, enhancing safety by removing the need to take one's eyes off the road. Wide Compatibility This car HUD head-up display is compatible with any phone under 5.5 inches. Warranty Every Mpow Product includes a 45 days money back & 18-month worry-free guarantee! read more

Mpow
¤16.99-¤10.99
at Amazon.com

Simple Usage Modes Just push the Mpow mount holder into the CD slot, it will get stuck firmly. Then place the metal plate between... your device and it can hold your smartphone safely. 360 Degree Swivel Innovative ballhead construction allows you to quickly adjust to optimal angle in 360 degrees. No Blind Side. Three-sided Clip Three-sided cradle keeps your sensitive electronic devices firmly in place while still allowing full function. Two cushioned side grips keep your electronic device safe and secure, while a detachable ledge creates a resting shelf for additional support. Remove your device easily and quickly with a push-button release. Wide Compatibility Up to 3.9in locking range allows large phones with thick otter box. Phone models included: iPhone 5s/6/6s/6s Plus, HTC One, Google Nexus 4/5 P, Nokia Lumia 920/1020, and more. Note According to customer' review, the car phone holder is not suitable for these models? 1.LEXUS F-350 2006?Lexus ES300 2016?Lexus is 250 2008?Lexus RX 350?Lexus NX200t 2015? 2.Ford Focus 2014?F-150 2017?Ford Fusion?Ford Escape 2015?Ford C-Max 2015?Ford Focus SEL 2012 3.Nissan 2001?Nissan 2011?Nissan Tundra?Maxda CX-5 2017?Hyundai Tucson 2017?Sonata Hybrid 2013?2006 Toyota Tacoma 4.Cadillac SRX?Cadillac CTS 2010?Honda Accord?2015 Chevy Tahoe?2011 Chevy Equinox ?dodge grand caravan 07 Warranty Every Mpow Product includes a 45 days money back & 18-month worry-free! read more

Mpow
¤32.99-¤20.99
at Amazon.com

360 Degree Fill Light Rotation &Mirror; The selfie stick provides a wide-angle LED light-compensation lamp with brightness adjustm...ent mode which makes the product perfect for night or indoor use. The mirror is convenient to look for a better angle for the photograph. No Worry for Power Off Integrated rechargeable 1500mAh super large capacity battery (50 times larger than others) can be charged by the micro USB charger cable and will provide about 72 hours of LED fill light time, 30 hours of Bluetooth connection time or 3 years of standby time on a single charge. Universal Fit for Most Smartphones This selfie stick is compatible with smartphones with a width between 1.8 to 3.3 inch. It matches phones of IOS 5.0 /Android 4.2 or above, which include iPhone 7 plus,6s, 6s plus, Google Nexus 5, 4 and etc. For devices of iOS 10 or later, the selfie stick may not automatically reconnect for next use. Extendable and Foldable It can be extended to 33.9 inches, long enough to take some group photos. It is small enough to take it anywhere with a carrying case, whether in your pocket or on your handbag. Perfect for parties, concerts, traveling, sports, video blogging, weddings, beach, aerial photos. 270 Degree Adjustable Head The mount at the top of the selfie stick can be positioned at any point through a 270 degree, allows a variety of shooting angles from traditional selfies to above-crowd shots. Package Included: 1 x Selfie Stick 1 x USB Charging Cable 1 x Carrying Bag Note: Please note that the fill light cable is used to plug into the fill light port on the selfie stick- to turn on the fill light. read more