Shop SoundAndVision
Refine By

Mpow Headphones

  • Sort By:
Mpow

bluetooth 4.1 adopts bluetooth 4.1 this headphones connect to your phone or tablet up to 32 feet while ensuring robust and clear s...ound comfortable fit with ergonomic design and soft silicone ear hook this in ear bluetooth headphone fits... read more

Mpow
¤31.99-¤11.99
at Amazon.com

Designed for SportsThe stylish wireless back head design is made for sports enthusiasts. It?s time to free yourself from those ent...angled/coiled long lines !Great SoundCSR 8645 chip, aptX technology, surrounded stereo sound are all built in Mpow Seashell just for creating excellent music and movie experience.Noise CancellationThe 6th generation CVC technology reduces outside noises and enables clearer sound from microphone. You can get high quality, hands-free phone conversation even on the street or inside the shopping mall.WarrantyEvery Mpow Product includes a 45 days money back & 18-month worry-free! read more

Mpow

<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters... out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. Noise cancelling microphone further guarantees clear sound for hands-free calls.</p> <p><b>Wireless Freedom</b></p> <p>With a battery life of 8 hours continuous wireless playback, our product won't let you down. However, if you do find yourself unable to recharge, you have the option of using the included audio cable(Wired mode without microphone). The headphone is optimized for portable audio including mp3, CD players, iPad, iPod iPhone, and other Bluetooth mobile devices.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes the headphone easy to take along on vacation or business trip. You can store it in your bag for use at work when you need to focus. </p> <p><b>Wearing Comfort</b></p> <p>Super soft ear cushions help lock your ear snugly and the ultra-light weight of the overhead headphone does not cause any burden to the ears, thus providing lasting wearing comfort.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

Mpow
¤28.99-¤17.99
at Amazon.com

Wireless Sport Headphones Specially designed for sports enthusiast, the perfect music partner for sports and running. Robust & D...ynamic Sound Adopt Bluetooth 4.1, this sports headphone offers incredible sound quality with deep extremely deep, distortion-free bass and truer sounds and delivers stable and strong signal than the general Bluetooth headset in a 32-feet working distance. Handsfree Function This Bluetooth headset can provide the true hands-free convenience and exceptional ease-of-use, so that you you can get hands-free phone conversation with clear voice even in noisy environment like inside a gym and running/cycling on the road. Metal-constructed Shell Featured with exquisite metal-constructed shell, this in-ear headphones is well-designed and high-end that can create the metal sound chamber. Multipoint Function The three smart button in-line control with microphone allows you conveniently control your music-playing options and answer or end calls. Package Includes: 1 x Mpow Coach Bluetooth Sport Headphone 3 x Ear Tips(Small, Medium, Large) 1 x Micro USB Charge Cable 3 x Indoor Leisure Fit Ear Hooks 3 x Outdoor Sport Fit Ear Hooks 1 x User Manual read more

Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Mpow
¤79.99-¤36.99
at Amazon.com

Immersive Hi-Fi Sound Designed for an excellent listening experience, Mpow Bluetooth headset with CSR chip and around-ear cushion ...design can provide robust, immersive and Hi-fidelity sound. Advanced Compatibility The Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV. Foldable and Portable Design The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. Dual mode: Wireless & Wired In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; In the wired mode: Used as a wired headphone with an audio cable. Note: 1. Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. 2. The microphone only works in the wireless mode. Specification Bluetooth Version: 4.0 Range: 33 feet (10 meters) Talking Time: Around 15 hours Playback Time: Around 13 hours Charging Time: 4 hours Charging Voltage: 5V Battery Capacity: 420mAh Packing List 1x Mpow Bluetooth Headset 1x 3.5mm Audio Cable 1x USB Charging Cable 1x Packing Bag 1x User Manual Warranty Every Mpow product includes a 45-day money back & 18-month warranty. read more

Mpow
¤79.99-¤37.99
at Amazon.com

Advanced CompatibilityThe Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devi...ces within 33 feet. THOUGH, according to the results of Mpow consumer surveys for three years, 99% issues about Bluetooth connection from the customers' feedback are due to their misunderstanding and improper operation which can always be solved easily after the personalized guidance, Thus:1. If you can't connect this headphones to your cell phones or other devices, please ask us for a complete FAQ guidance of Bluetooth Headphones, you can find the solutions finally!2. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV. Dual mode: Wireless & Wiredthe wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; the wired mode: Used as a wired headphone with an audio cable.Note:1. Firstly, The ear cushions(inner diameter:1.3~3.3 inches) are designed as over-ear, not on-ear. Feeling like "on-ear" or "not over-ear enough "only depends on your ear size/shape. Secondly, please keep the headset in dry and cool environment as the ear cushion is made of memory-protein materials.2. The microphone only works in the wireless mode.3. Depending on your head/ear size/shape, this headphones may be a little tight(feels like "on-ear") for someone which is designed to avoid sound leakage.In case of that and to get both audio and wearing comfort, please take off the headphone every 1-2 hrs to get your ears relax and protect them from lasting muggy environment in use.Foldable and Portable Design?The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability.Specification:Bluetooth Version: 4.0Range: 33 feet (10 meters)Talking Time: Around 15 hoursPlayback Time: Around 13 hoursCharging Time: 4 hoursCharging Voltage: 5VBattery Capacity: 420mAhPacking ListPacking List:1x Mpow Bluetooth Headset1x 3.5mm Audio Cable1x USB Charging Cable1x Packing Bag1x User Manual read more

Mpow
¤39.99-¤16.99
at Amazon.com

Color: Black With the latest Bluetooth 4.1 technology and the advanced CSR chip, our sports earphones are dedicated to provide sup...erb sound quality experience. Stylish ear hooks fit well to your ears for worry-free exercising. Premium Sound Quality Adopted innovative A2DP technology, Bluetooth earphones allow you to enjoy clear and natural sound when running. Stable Bluetooth Signal Bluetooth 4.1 technology features faster and more stable signal transmission, high sound quality and low energy consumption. Support two Bluetooth mobile phones pairing simultaneously. Lightweight and Comfortable Our lightweight earphones come with ergonomic designed ear hooks that provide comfortable wearing without falling out easily. The ear tips ensure a good seal in the ear that minimizes the outside distractions and makes you focused on the things that matter. Hassle-free Calling Built-in HD microphone transmits crystal clear voice for hassle-free conversations. You can easily control multifunction like music and calls via the button on the Bluetooth earphones. Long Battery Life Improved lithium battery ensures up to 7 hours talking time, 6 hours music time and up to 160 hours stand-by time. Warranty The product includes a 45 days money back & 18-month warranty. Specifications: Bluetooth Version: V4.1 Bluetooth Profiles: Headset, Handsfree, A2DP, AVRCP Charging Port: Micro USB Standby Time: up to 160 Hours Talk Time: up to 7 Hours Playing Time: up to 6 Hours Weight: 1.2oz Package Included: 1× Bluetooth Sports Earphones 1× USB Charging Cable 3× Different Sizes Ear Tips (Small/Medium/Big) 1× User Manual read more

Mpow
¤7.49 ¤9.99
at Amazon.com

High Fidelity Sound High performance speaker ensures extended frequency range. Enhance the bass and crisp high so that you can fu...lly enjoy the distinct and natural sound. Effortless to Use With extremely flexible tangle-free cable including inline controller, you can control the calls and music via the multifunctional button. Short press to play, pause music or answer a call. Long press to reject or end a call. Built-in microphone makes you free to chat with your friends or listening to music for leisure, running, jogging and etc. Easy to Carry The additional spring-loaded clip can be attached to your shirt collar or jackets for fixing the wire and convenient carrying. Therefore, you are no longer worried about losing your headphones while you take out the headphones from your ears and wear around your neck. Specifications: Frequency Response: 20Hz-20 KHz Impedance: 32?±15% Plug: 3.5mm Gold-plated Plug Cord Length: 1.2m±0.05m (3.9ft±0.2ft) Package Included: 1×In-ear Headphones 3×Different Sizes Ear Tips (Small/Medium/Big) 1×Clip read more

Mpow

<p><b>Stereo Hi-Fi Sound</b></p> <p>Designed for an excellent music & communication experience, Mpow headset adopts the best CSR c...hip together with CVC6.0 noise cancelling technology for isolating outside noise, providing rich and dynamic audio. </p> <p><b>Advanced Compatibility</b></p> <p>The Bluetooth headset can easily and quickly connected with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. </p> <p><b>Dual mode: Wireless & Wired</b></p> <p>In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; In the wired mode: Used as a wired headphone with an audio cable.</p> <p><b>Note: </b></p> <p>1.Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. <br> 2.Microphone only works in the wireless mode. </p> <p><b>Specification</b></p> <p>Bluetooth Version: 4.0<br> Range: 33 feet (10 meters)<br> Talking Time: Around 15 hours<br> Playback Time: Around 13 hours<br> Charging Time: 4 hours<br> Charging Voltage: 5V<br> Battery Capacity: 420mAh<br> </p> <p><b>Packing List</b></p> <p>1x Mpow Bluetooth Headset<br> 1x 3.5mm Audio Cable<br> 1x USB Charging Cable<br> 1x Packing Bag<br> 1x User Manual<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45-day money back & 18-month warranty.</p> read more

Mpow

<p><b>Mpow Enchanter Bluetooth Earbuds</b></p> <p><b> </b></p> <p><b>Sound Leadership</b></p> <p>The latest Bluetooth 4.1 technolo...gy and best CSR chip provide strong signal quickly and easily connecting, giving these wireless earbuds robust stereo sound quality.</p> <p><b>Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. 3 pairs of ear cups are supplied which isolate ambient noise well when listening to music. </p> <p><b>Designed for Sports</b></p> <p>No worry for sweat out any more, the circuit board inside earphone is coated with sweat-proof and corrosion-resistant nano-material, which greatly protects sport headphones from sweat and water.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Product Specification</b></p> <p>Bluetooth Version: V4.1<br> Charging Time: ?2 hours<br> Standby Time: 400 Hours<br> Play Time: 6 Hours<br> Talk Time: 7 Hours<br> Bluetooth Profile: AVRCP/A2DP/HSP/HFP<br> Battery: 3.7V / 100mAh<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

Mpow
¤45.99-¤20.99
at Amazon.com

Bring Music Where You SweatThanks to the IPX7 sweatproof rating, Mpow sports earbuds keeps the headphones protected and in peak co...ndition whether you're getting drenched in sweat after a grueling workout.Hear Richer Sound in The Right WayDifferrent people like different audio styles(someone favor bass, mid, or high), and have different Ear sensitivity, what we can do is to make as richer as possible audio range for you: We tuned this bluetooth headphones especially the bass part which is the chief lack for most in-ear earbuds, Hence, you can get more balanced sound with warm bass except for the Bluetooth distortion, If there is any sound loss, you can readjust it to fit your ears more tightly to get richer levels. Always Stay ComfortableErgonomic and shallow in-ear design, soft silicone ear hooks, and memory foam ear tips brings secure fit without hurting your ears, enables comfortable wearing experience.Portable Gym-ready Carrying Pouch & Cord clip Come with an EVA bag with cushioned interior which allows you to store your earbuds safely and prevent the scratches in your training routine, The cord clip can shorten the wire to fit your back neck or head, beacouse the long wire may bother your move and cause stethoscope effect.Note:(1) Please keep your headphone charged when in low battery to achieve better Bluetooth connection and battery protection.(2) Please choose suitable ear tips and wear your headphone tightly when you are running or cycling, it will help you reduce annoying wind noise as much as possible.Be Safer in Less Noise Isolation:The shallow in-ear design is not only for comfy wearing but also for your safety on the move, it won't blocks all the environment noises to keep you more aware of the surrounding, which is more suitable for sports like running, cycling or hands-free talk in the work.If you want to block some unwanted noises: you can push the earbuds deeper inside your ears canal or turn up your music.Specifications:Bluetooth Standard: V4.1Wireless Profile: Headset, Handsfree, A2DP, AVRCPOperating Range: 10m(33ft)Standby Time: 220hrsCharging Time: 1.5hrsTalk /Playing Time: 7hrsCharging Voltage: DC 5VBattery Capacity: 100mAh/3.7VPackage Contents:Mpow Earphone× 1 Regular Ear Tips(S,M,L) × 3 Pairs Memory Foam Ear Tips× 1 Pair Cord clip × 1EVA Carrying Case× 1 Charging Cable× 1 read more

Mpow
¤15.99-¤9.99
at Amazon.com

High Fidelity Sound High performance speaker ensures extended frequency range. Enhance the bass and crisp high so that you can fu...lly enjoy the distinct and natural sound. Effortless to Use With extremely flexible tangle-free cable including inline controller, you can control the calls and music via the multifunctional button. Short press to play, pause music or answer a call. Long press to reject or end a call. Built-in microphone makes you free to chat with your friends or listening to music for leisure, running, jogging and etc. Easy to Carry The additional spring-loaded clip can be attached to your shirt collar or jackets for fixing the wire and convenient carrying. Therefore, you are no longer worried about losing your headphones while you take out the headphones from your ears and wear around your neck. Specifications: Frequency Response: 20Hz-20 KHz Impedance: 32?±15% Plug: 3.5mm Gold-plated Plug Cord Length: 1.2m±0.05m (3.9ft±0.2ft) Package Included: 1×In-ear Headphones 3×Different Sizes Ear Tips (Small/Medium/Big) 1×Clip read more

Mpow
¤28.99-¤19.99
at Amazon.com

Please Note: About Bluetooth Connection:The Bluetooth headphone can easily and quickly connect with smartphones, tablets, TVs and ...other Bluetooth devices within 33 feet. THOUGH, according to the results of Mpow consumer surveys for three years, 99% issues about Bluetooth connection from the customers' feedback are due to their misunderstanding and improper operation which can always be solved easily after the personalized guidance, Thus: 1. If you can't connect this headphones to your cell phones or other devices, please ask us for a complete FAQ guidance of Bluetooth Headphones before judging them defective since Mpow has a strict Bluetooth standard, you can find the solutions finally!2. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV. Flexible & Lightweight Weighs only 1.3 oz in flexible and durable silicone neckband, it is light as a feather, you will be not conscious of having it on your neck, no cable tangling when in use, and just hang around your neck when not in use. Specification Bluetooth Standard: Bluetooth V4.1 Operation Range: Up to 33ft (10m) Battery: 100mAh Music Playback: Up to 6h Talk Time: Up to 6.5h Standby Time: 200h Charging Time: 1.5h Packing List 1xMpow Bluetooth Headset 1xUser Manual 1xUSB Charger Cable 3x Pairs of Ear-tips(S,M,L) Warranty Every Mpow product includes a 45 days money back & 18-month warranty. read more

Mpow
¤32.99-¤20.99
at Amazon.com

Mpow Enchanter Bluetooth EarbudsPlease Note: About Bluetooth Connection:1. If you can't connect this headphones to your devices, p...lease ask us for a complete FAQ guidance of Bluetooth Headphones before judging them defective since Mpow has a strict Bluetooth standard, you can find the solutions finally!2. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.Sound Leadership The latest Bluetooth 4.1 technology and best CSR chip provide strong signal quickly and easily connecting, giving these wireless earbuds robust stereo sound quality. Voice Clarity Featured with noise cancellation technology, the headphone intelligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. 3 pairs of ear cups are supplied which isolate ambient noise well when listening to music. Hands Free Calling Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane. Product Specification Bluetooth Version: V4.1 Charging Time: ?2 hours Standby Time: 400 Hours Play Time: 6 Hours Talk Time: 7 Hours Bluetooth Profile: AVRCP/A2DP/HSP/HFP Battery: 3.7V / 100mAh Warranty Every Mpow product includes a 45 days money back & 18-month warranty. read more