Shop SoundAndVision
Refine By

Wireless Headphones

  • Sort By:
Bowers & Wilkins
¤399.99
at Amazon.com

An evolution of the award winning P7, the P7 Wireless raises the bar yet again for truly mobile headphones. With Bowers & Wilkins ...loudspeaker technology, P7 Wireless headphones are able to provide a breathtakingly insightful performance, utilizing Bluetooth aptX's ease and reliability of connectivity. Delivering all the highs and los of your favorite music, in style, cable free and wherever you may be. read more

Sennheiser
¤399.95
at Amazon.com

Created with the music lover in mind, the RS 185 now makes it possible to enjoy dynamic, high-fidelity Sennheiser sound at home wi...thout the hassle of wires. These innovative, ergonomically designed, wireless open headphones deliver amazingly precise sound reproduction in uncompressed digital quality even as you wander from room to room, and they are light and comfortable enough for extended periods of use. Furthermore, the conveniently located manual input level and balance controls make setting the listening levels to your individual preference a snap, so you'll be able to fine-tune the details of each track in stunning acoustic clarity. Just connect the multi-purpose transmitter to your home sound system (via optical or analog inputs) and lose yourself in the music. Sennheiser's RS 185: The right wireless choice for serious listeners. read more

Sharper Image

Crank up the volume - not with buttons, but with a volume dial. It's a new way to control your music. Wireless Headphones by Sharp...er Image boast a dial that fills the ear cup, a statement piece sure to be the subject of conversation. Turn the dial to adjust the volume and enjoy every note of the definitive stereo sound the headphones dole out. Control music playback and phone calls from the buttons on the ear cup for a completely hands-free experience. Pair the headphones with any compatible smartphone, tablet, or other Bluetooth-enabled device to enjoy music, movies, and podcasts. The cushioned ear cups and adjustable headband work together for a comfortable and secure fit. read more

BÖHM
¤159.95
at Amazon.com

<b>Wireless Bluetooth Headphones that help you disconnect - literally & figuratively.</b><br> Escape the everyday with your favori...te tune or audiobook anytime, anywhere. These advanced Headphones from BÖHM help you disconnect from your surroundings and from the headache of tangled wires. Make an easy lifestyle upgrade and enjoy the latest in Bluetooth technology with these premium wireless headphones. <br>The primary distinction between these headphones and others on the market is the Active Noise Cancellation technology, which unlike passive noise isolating designs, actively cancels ambient noise for focused listening.<br><br><b>Premium Stereo Drivers</b><br>Want a powerful pair of bass headphones? The two high-end drivers crank out powerful, thumping bass, prominent mids and truly sparkling highs. The driver units measure in at 40mm and feature an impressive frequency range of 20hz-20khz.<br><br><b>Rechargeable Battery</b><br>While the built-in 290mAh rechargeable lithium ion battery charges in a rapid 3 hours, it provides for up to 16 hours of continuous music playback or up to 18 hours of continuous talk time on a single charge. (Max rating at 50% volume.) A premium Aux cord is also included for a wired connection option. Safely store your headphones in the slim, ultra-protective carrying case.<br><br><b>Comfort & Convenience</b><br>The supple leather ear cups & headband rest softly for endless hours of fatigue-free listening - making them perfect as headphones. An inline remote and microphone add convenience: take hands-free calls & resume your music with no hiccups.<br><br><b>Luxurious Style & Detail</b><br> The lightweight aluminum housing features zinc alloy metal detailing, while the ear cups are swathed in gorgeous protein leather. The BÖHM B-66 outfits you with a high level of luxury that's rarely found in headphones - at any price point.<br><br> PLEASE NOTE - Take care adjusting the Headphones as severe manipulation of the Headphones can damage them read more

Fetta
¤19.99 ¤219.99
at Amazon.com

<b>Features</b> <br> <br> 1. Steady Bluetooth 3.0 single, you can enjoy the convenience of wireless communication. <br> 2. You can... control your music quickly and easily with controls located on the headphone <br> 3. With Foldable designing,it convenient to carry and adjust suitable size. <br> 4. Easy Pairing to bluetooth devices.Build in 3.5mm audio jack,it supports multi-media playing <br> 5. External noise relief technology and stereo provide a personal music world to you. <br> 6. Enjoy wonderful stereo music and hands-free calls <br> 7. Can freely control the switch of previous song and next song, pausing song, answering calls, ending calls, refusing the incoming call, dialing the last number, volume control <br> <br> <b>Specifications</b> <br> <br> Bluetooth Specification : V3.0+EDR class 2 <br> RF Frequency: 2.402-2.480GHZ <br> Wireless range:about 10 meters <br> Micro USB Charging Port <br> Charger adapter output: DC 5V <br> Music Playback Time: 8 hours <br> Talk Time:6~8 hours <br> Charging Time:2.5hours <br> <br> <b>Package includes</b> <p></p> <p>1 x Studio headphone<br> 1 x Charging cable<br> 1 x Audio cable<br> 1 x User Manual </p> <p><b>Warranty</b></p> <p>Only items purchased from our store come with a 30 day money back guarantee or a full exchange of the item. Any damage to the product caused by the buyer will not be refundable. And All our products come with a 12 month manufacture's warranty</p> read more

SOL REPUBLIC
¤179.99
at Amazon.com

It's the way we always wanted a headphone to be - two independent wireless earbuds completely free from any wires or neckbands. AM...PS Air is True wireless freedom with premium sound for your music, rain, water and sweat resistant for your workouts, integrated microphone for calls, play/pause music control, and Ultra light with silicone Air grooves for long lasting comfort and secure fit. Compatible with all Bluetooth devices. You'll hear. Big Deep bass with amazing clarity and detailed highs. read more

Sony

<b>Sony 900MHz RF wireless transmission Wireless Stereo Noise Reduction Headphone System</b><br><BR> These wireless headphones fro...m Sony provide you the freedom to roam freely through your house while listening to your favorite tunes. Simply connect the RF transmitter to an audio source such as a television or home sound system and you're free to walk up to 150' away. Noise reduction technology reduces interference so you get the cleanest signal possible. The transmitter also acts as an induction charger for the headphones, so you can cradle them quickly without worrying about pin contacts.<br><BR> The headphones are designed to keep you comfortable for hours, thanks to the adjustable, padded headband and thickly-cushioned earcups. The 40mm neodymium drivers provide great sound with a full frequency range so you hear every detail. The headphones feature automatic on/off and have a built-in volume control so you can make adjustments without returning to the audio source.<br><BR> <b>Cordless Headphones</b><br>Enjoy high-fidelity sound, at home, in wireless freedom<br><br> <b>Long-term comfort</b><br>The easy-adjust headband allows for long-term comfort and ease-of-use<br><br> <b>Expressive sound</b><br>40mm drivers deliver deeper bass and audio clarity for a superior home entertainment experience<br><br> <b>Quality sound</b><br>Wireless radio-frequency transmission provides quality indoor transmission. (Up to approximately 150 ft)<br><br> <b>Fast charging</b><br>Quick charging your headphones is a breeze with the secure charging system. A 3.5 hour charge will produce a full charge of approximately 25 hours. recharge function<br><br> <b>Specifications</b><br><br> <b>Audio</b><br><br> Audio Modes: Mute: Operates when RF signal is weak or not received<br> Channel Selection Select by a slide switch<br> Driver Unit 40 mm<br> Effective Range: Approximately 150 feet (45 m)<br> Frequency Response 10-22000 Hz<br> read more

1More

<div class="boost-aplus-container"> <div class="boost-row"> <div class="boost-col-mbl-12 boost-col-tblt-push-1 boost-col-tblt-10"...> <p>Our iBFree Bluetooth In-Ears uniquely bring wireless freedom and pristine sound together. Their lightweight stylish design, meticulous wireless transmission, and titanium drivers deliver superior sound while you stay active.</p> </div> </div> </div> read more

Bluedio
¤39.99 ¤79.99
at Amazon.com

<B>T3</B> , the latest Bluetooth headphones of Turbine Series, is designed and created by our professional Bluedio team. Compared ...with T2, it has a number of major upgrade: Zn alloy frame and body ensures it's sturdy enough to be unbreakable and durable; 57mm titanizing diaphragm leads to a better resolution, quicker response and dynamic and swift sound; the totally new 3D sound, adopted by Turbine Series for the first time, will give you a more wonderful sound experience. <br> <br><B>Warranty and Customer Service information</B> <br>1 year warranty from the date of purchase <br>Email Bluedio Customer Service, get answered under 24 hours <br>To email Bluedio Customer Service: you can click "Your Account" on Amazon, click"Your Orders", find the Bluedio order, click "Contact Seller". <br> <br><B>Note</B> <br> 1.There is a new added Play/Pause button on T3. <br> 2.Operations such as skipping forward/back and Volume+/- on T3 are contrary to previous headphones. <br> (Specific information please refer to the user manual.) <br> <br><B>Specifications</B> <br> Bluetooth version: 4.1 +EDR <br> Bluetooth transmission frequency: 2.4GHz to 2.48GHz <br> Bluetooth operating range: up to 33 feet (free space) <br> Profiles: A2DP, AVRCP, HSP, HFP <br> Audio resolution: up to 24bit@48KHZ <br> Drivers: ?57mm <br> Impedance: 16? <br> SPL: 116dB <br> Frequency response: 15Hz-25,000Hz <br> THD: <0.1% <br> Standby time: up to 1100 hours <br> Bluetooth music/talk time: about 20 hours <br> Charging time: 2 hours for full charge <br> Operating temperature range: -10 ? to 50? only <br> Headphones dimensions: 159*126*78mm <br> Package dimensions: 251*170*95mm <br> Headphones weight: 388g <br> Package weight: 955g <br> <br><B>In the box</B> <br> Bluedio T3 Bluetooth headphones <br> 3.5mm audio cable <br> USB charging cable <br> Drawstring carry bag <br> User manual read more

BROOKSTONE
¤95.09 ¤99.99
at Amazon.com

Digital Wireless TV Headphones. Hear every detail in your TV show, movie, or video game. Connects to your TV, stereo, computer, ca...ble box, or gaming system 2.4GHz-2.5GHz Digital UHF technology provides crisp, clear sound up to 75 feet (25 m)--even through walls! Automatic frequency-switching technology ensures no interference with other devices Features noise reduction and high-def audio with deep bass effect Soft-touch padded earcups are comfy enough for hours of binge-watching your favorite show or playing your favorite video game Built-in rechargeable battery--just rest the headphones on the included charging base when not in use Li-ion battery lasts up to 8 hours on a single charge Includes AUX cable for wired connections to your TV, stereo, computer or mobile device Great sound without the wires! Stop fighting over the TV volume once and for all! With our Digital Wireless TV Headphones, you can get crisp, clear, LOUD sound without disturbing those around you. Late night sports game? Want to stay up all night playing that new video game? Now you can enjoy your favorite shows, movies, or video games while your partner sleeps soundly beside you. Order your Digital Wireless TV Headphones from Brookstone today! read more

Teaeshop

<br>Bluetooth V4.1 <br>Built-in microphone <br>Support music play/pause <br>Micro-USB charging connection <br>Supports Profiles: A...2DP, HFP,HSP AVRCP <br>Talking Time: 5-6 hours <br>Music playing time: 5-6 Hours <br>Charger time:about 2 hours <br>Standby time:about 100 hours <br>Effective range:about 10 meters <br> <br> <b>Pair with Bluetooth Devices <br>a: Long press Power Button for about 5 seconds , till LED remains blue. <br>b: Enable the Bluetooth function of the device and search for available Bluetooth devices, then select "Bluedio" from the search results. (Some mobile phones need to input PIN "0000" as password) <br>c: When the LED flashes blue, means it is connected. <br> <br> <b>Package Include: <br>1* Bluetooth Headset <br>1* USB Cable <br>1* User Manual read more

Bose
¤279.00
at Amazon.com

Enjoy a better wireless experience with Bose sound link around-ear wireless headphones ii. Exclusive technology delivers deep, imm...ersive sound at any volume, making them the best-sounding wireless headphones available. A dual microphone system rejects noise and wind so you'll be heard loud and clear. And enhanced side tone makes your voice sound more natural. Sound link wireless headphones use the latest Bluetooth technology so you can easily connect to your mobile devices with seamless audio/video sync and switch between two devices. For nfc-enabled devices, you can simply tap the right ear cup for quick pairing. A rechargeable lithium-ion battery lets you listen for up to 15 hours and gives you up to 2 hours of play time with a 15-minute charge. Effortless touch controls allow for simple command of your music and calls. And voice prompts give you information about battery life, device connection and caller id. Sound link wireless headphones are lighter and more comfortable than other comparable wireless headphones so you can enjoy them all day long. Wear them almost anywhere, and experience uncompromised wireless performance. Included: sound link around-ear headphones; detachable audio cable; carrying case. read more

Sony

Wireless freedom, sleek comfort, and unmistakable bass response add-up to an unforgettable audio experience. Connect via Bluetooth... with NFC and let your music loose for up to 20 hours (battery life) anytime anywhere. 40mm drivers with electronic bass boost will add punch to your favorite tracks. read more

Bose
¤349.00
at Amazon.com

Quiet Comfort 35 wireless headphones are engineered with world-class noise cancellation that makes quiet sound quieter and music s...ound better. Free yourself from wires and connect easily to your devices with Bluetooth and NFC pairing. Volume-optimized EQ gives you balanced audio performance at any volume, while a noise-rejecting dual microphone provides clear calls, even in windy or noisy environments. Voice prompts and intuitive controls make communicating and controlling your music hassle-free. A lithium-ion battery gives you up to 20 hours of wireless play time per charge. And if you anticipate a situation where charging may not be possible, just plug in the included audio cable. Wired mode gives you up to 40 hours of play time per charge. Premium materials make these headphones lightweight and comfortable for all-day listening. Use the Bose Connect app for a more personalized experience. Included: Quiet Comfort 35 wireless headphones; USB charging cable; backup audio cable; airline adapter; carry case. read more

FIIL
¤27.99 ¤48.99
at Amazon.com

<p>They're sturdily built, sweat-proof and-most importantly-they sound amazing. They're the perfect accessory for your versatile l...ifestyle. </br> No matter how hard you go or how tough the conditions, move with freedom and confidence and let nothing limit where the music takes you. Enjoy your jogging, working out, cycling or just hanging out listening to your favorite music and watching videos.</br> Convenient on-board controls on the Bluetooth Headphones allow you to answer calls, skip tracks and pause/play your music without the need to reach for your phone. Lightweight - Comfortable Bluetooth headphones weighing less than 1oz,comfortably through clothing and bags. On Board Controls- Easy access to music and volume controls through Bluetooth.</br> <b>Features</b></br> - Premium drivers that deliver deep rich bass</br> - Secure fit, comfortably stays put in your ears</br> - Lightweight comfortable design</br> - 6 Hour rechargeable battery</br> - Adjustable clip </br> - Magnetic connection design</br> - Sweat proof function</br> - Voice Prompt</p> <p><b>NOTE:</b>Using headset too long time or too loud will damage your hearing.</p> <b>Package contents:</b></br> 1 X Bluetooth Headset </br> 1 X USB Cable</br> 1 X Silicone Ear Buds</br> 1 X User manual</br> 1 X Warranty card read more

Sony
¤349.99
at Amazon.com

Breathtaking sound never looked so good with these wireless Bluetooth headphones with digital noise cancelling that combine High-R...esolution sound compatibility, striking design and long-listening comfort. Easy, one-touch connectivity. No distracting background noise. No annoying cables. Just the pure, authentic sound. Get ready to lose yourself in the music. read more

Beats
¤299.95
at Amazon.com

With up to 40 hours of battery life, Beats Solo3 Wireless is your perfect everyday headphone. With Fast Fuel, a 5-minute charge gi...ves you 3 hours of playback. Enjoy award-winning Beats sound with Class 1 Bluetooth wireless listening freedom. The on-ear, cushioned ear cups are adjustable so you can customize your fit for all-day comfort. read more

BRAINWAVZ

The Brainwavz BLU-200 wireless Bluetooth earphones designed in a stylish matt black aluminium body with an in-line remote takes au...dio listening to a whole new exciting level. Designed for easy mobility and tangle free hassle, the BLU-200 houses a micro 60mAh battery that will deliver 4 hours of continuous audio playback, 100 hours of standby and can be fully charged in under 2hrs. With a range of 30ft (10m), you can comfortably be away from your audio source with no disruption to audio quality or performance. <P> The low profile cabling, in-line remote and comfy fit of the earphones make them versatile while being on the move or being active. And if you want that extra security, a pair of ear hooks is included to ensure your BlU-200 are an absolute secure fit! <P> The BLU-200 comes with 3 sets of silicone ear tips in small, medium and large sizes and 1 set of ComplyTM for added comfort and enjoyable listening. <P> Specifications: <P> Drivers: Dynamic, 9.2 mm <br> Rated Impedance: 16 O <br> Frequency Range: 20 Hz ~ 20 kHz <br> Sensitivity: 96 dB at 1 mW <br> Maximum Input Power: 3 mW <br> Bluetooth 4.0 (CSRBC8645) with aptX <br> Operation max distance: 30ft (10m) <br> Battery: 60mAh - 4hrs playtime, 100hrs standby, 2hrs for full charge (Micro USB charging) <br> CVC echo and noise cancellation <br> Supports HFP, HSP and A2DP <br> Supports pairing with two devices at the same time <br> 3 button remote, works with Apple iOS products, Android & Windows phones & PC <br> 24 Month warranty <P> read more

BENWIS
¤49.99 ¤89.99
at Amazon.com

<b>Specification</b><br>Speaker Unit: ?40mm<br>Speaker Sensitivity: 122dB/mwat1KHz<br>Impedance: 32?<br>Frequency Range: 20Hz-20KH...z<br>Bluetooth Version:CSR4.0<br>Mic Sensitivity:20M<br>MIC Sensitivity:-58dB<br>MIC irectionality: Omnidirectional<br>Support Mode: A2DP, AVRCP, HFP, HSP<br>Talk Time: 8 hours<br>Open Distance: 8-12m<br>Standby Time: 1000 hours<br>Charge Time: 2 hours<br><br><b>How to connect with your cell phone</b><br>1. Make sure the headphone is turned on.<br>2. Start pairing mode by pressing the Bluetooth headphone switch / answer button for 2 seconds until the red and blue lights flash alternately.<br>3. Activate the Bluetooth function on your phone, search for Bluetooth devices and select the model named H800. Enter the password "0000"(usually asked for the first time) to complete the pairing. When finishing pairing mode, the headphone will emit the notification tone, the red and blue lights stop alternately flashing and turn into 1 flashing in 2 seconds.<br>4. When the pairing mode is activated, if you fail to complete the pairing process within 5 minutes, the Bluetooth headphone will automaticly turn off to save power. For continuing pairing, please restart the Bluetooth headphone to the pairing status.<br><br><b>Smart one for two function</b><br>H800 Bluetooth headphone can simultaneously connect to two mobile phones, avoid the troubles for users who have two mobile phones.<br>One for two matching method:<br>First, make sure Bluetooth headphone is successfully paired with the first mobile phone, then turn off Bluetooth of paired mobile phone, so the Bluetooth is disconnected. Second, redo the pairing process with the second mobile phone. After pairing successfully, turn on the Bluetooth function of first one mobile phone and connect it. read more

Sennheiser
¤224.81
at Amazon.com

Taking home entertainment to the next level, Sennheiser's RS 175 offers an impressive range of features in a compact, ergonomic pa...ckage, so that you can enjoy music and television to the fullest. The Bass Boost and Surround Sound listening modes will allow you to experience your home entertainment system like never before - the former increases the audio bass response while the two virtual surround modes offer a more spatial and livelier stereo sound. What's more, the innovative digital wireless technology ensures that signal transmission remains clear and accurate as you move from room to room. Additionally, the user-friendly design makes it easy to set up and enjoy the RS 175. The main controls are located on the headphones, so nothing will distract you from an exciting audio experience, and the comfortable fit is ideal for extended periods of use. Sennheiser's RS 175: Home entertainment just got more entertaining! read more

Hamaxa

<b>Sound Leadership & Voice Clarity</b><br> <br> Featured with noise cancellation technology, the bluetooth over ear headphone int...elligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. Noise cancelling microphone further guarantees clear sound for hands-free calls.<br> <br> <b>Wireless Freedom</b><br> <br> With a battery life of 8-10 hours continuous wireless playback, Hamaxa bluetooth headset won't let you down. Besides,this bluetooth headset even also suppprt the TF Cards playing.And the headphone is optimized for portable audio including mp3, CD players, iPad, iPod iPhone, and other Bluetooth mobile devices.<br> <br> <b>Hands Free Calling</b><br> <br> Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.<br> <br> <b>Foldable and Portable Design</b><br> <br> The foldable design makes the headphone easy to take along on vacation or business trip. You can store it in your bag for use at work when you need to focus.<br> <br> <b>Wearing Comfort</b><br> <br> Super soft ear cushions help lock your ear snugly and the ultra-light weight of the overhead headphone does not cause any burden to the ears, thus providing lasting wearing comfort.<br> <br> <b>Warranty</b><br> <br> Every Hamaxa product includes a 12-month Quality warranty. read more

BÖHM
¤109.99 ¤169.99
at Amazon.com

<b>Effective Noise-Cancelling: </b>BÖHM has incorporated the most advanced active and passive noise cancelling technology in its h...eadphones. Immerse yourself in your music without distractions, wherever you are. <br> <br> <b>Advanced Bluetooth 4.0: </b> Cut loose and let the music carry you away with its generous 10 meter distance. <br> <br><b>Hands-On Control: </b> Featuring a power/multifunction button (MFB), volume and playback control buttons, Bluetooth indicator, and noise cancelling button & indicator incorporated seamlessly into your headset.<br> <br><b>Comfort & Convenience: </b> Cushioned ear pads cup ear and adjustable headband rest softly for endless hours of fatigue-free listening. With its folding design and included carry case, the B76 is convenient for storage and travel alike.<br> <br><b>Premium Build:</b> The B76's sturdy construction, soft leather and brushed metal finish will indulge all your senses, from your eyes to your fingertips.<br> <br><b>World Class Battery:</b> Advanced battery efficiency technology means you'll enjoy up to 16 hours of play time and 8 hours of noise cancelling on a lightning-fast 2-hour charge.<br> <br><br><b> Operating Notes:</b> <br> Before using your headphones for the first time make sure to charge them fully - at least 4 Hours (Ensure the included Micro-USB Cable is inserted into the Headphone's charging port as well as your power source)<br> Bluetooth Connecting: Hold down the MFB for 5-7 seconds until you hear the connecting Tone and the alternating Red/Blue lights. <br> Activating Noise Cancellation: Slide the switch over so that the Green light comes on. Please note, while these Headphones do have Noise Cancellation, they do not perfectly cancel out all surrounding noise.<br> Adjusting your B76 Headphones: By holding an Earcup and the Headband directly above that Earcup in each hand you can pull and adjust the size of the Headphones for the best fit.<br> read more

Bose
¤349.00
at Amazon.com

Quiet Comfort 35 wireless headphones are engineered with world-class noise cancellation that makes quiet sound quieter and music s...ound better. Free yourself from wires and connect easily to your devices with Bluetooth and NFC pairing. Volume-optimized EQ gives you balanced audio performance at any volume, while a noise-rejecting dual microphone provides clear calls, even in windy or noisy environments. Voice prompts and intuitive controls make communicating and controlling your music hassle-free. A lithium-ion battery gives you up to 20 hours of wireless play time per charge. And if you anticipate a situation where charging may not be possible, just plug in the included audio cable. Wired mode gives you up to 40 hours of play time per charge. Premium materials make these headphones lightweight and comfortable for all-day listening. Use the Bose Connect app for a more personalized experience. Included: Quiet Comfort 35 wireless headphones; USB charging cable; backup audio cable; airline adapter; carry case. read more

Reytid

This adapter will plug into your Shure SE215 SE425 SE535 SE846 Headphones and allow you to play music via Bluetooth from your audi...o device. Will work with ALL iPhone's, iPad's, Macbooks, Samsung, Sony, LG, HTC and ALL other Android Smartphones & Tablets. read more

iLive

Listen to your music wirelessly without compromise with the iLive Wireless Bluetooth Headphones. These headphones combine studio q...uality sound and premium comfort without messy wires to untangle. A built-in mic allows you to move effortlessly between music and calls and on-ear controls keep you in control of your music while your device is neatly tucked away. The built-in rechargeable battery can last up to 8 hours on a single charge. The wireless range is 33ft. Includes 3.5mm audio cable, USB charging cable and carrying bag. White. iLive products are specifically designed to enhance your digital devices including iPod, iPhone, iPad, Android, Blackberry, Mobile Phones, Tablets, Televisions, and Bluetooth Devices. Our focus is on delivering a great product that serves as an extension of a these devices, in both design and function, without compromising on audio quality, feature-set, or ease-of-use. read more

Aulker
¤21.99 ¤54.99
at Amazon.com

<b>Highlight Features: </br> ? Want a Comfortable, Great Sound, Strong Bass, Durable, Secure Fit Bluetooth Headset? Get the Real T...hing Here! </br> </br> ? Crystal Clear Sound with Heavy Duty Bass. Perfect for Workout and all kind of sports! </br> </br> ? Sweating, Rain, No Problem! IPX4 Water Resistant </br> </br> ? Super Easy to Pair with Bluetooth 4.1</b> </br> Just Search "Q7" to Pair, Compatible with 99% Bluetooth devices up to 33FT / 10M </br> </br> ? <b>Look Great and Feel Great, Ergonomic Design to Comfortable Perfect Fit Your Ear Securely </br> </br> ? Up to 8 H Music Play / Talk Time, Only 2 Hour Charging </br> </br> ? Hands-Free Calling with Built-In Mic </b></br> </br><b>Specification:</b> </br> ? Bluetooth: V4.1, Up to 33FT / 10 Meters </br> ? Water Resistant: IPX4- protected against splashing water from any angle </br> ? Battery Capacity: 110mAh 5V </br> ? Max Music Play Time: 8 H </br> ? Max Talk Time: 8 H </br> ? Charge Time: 2 H </br> ? Built-In Microphone: Yes </br> </br><b>Dimensions:</b> </br> ? Product Size: 2.17 x 1.69 x 1.18 INCH / 5.5 x 4.3 x 3 CM </br> ? Product Weight: 0.67 Oz / 19 g </br> ? </br><b>What Is In The Package:</b> </br> ? Aulker Wireless Bluetooth Headset x 1 </br> ? USB Charge Cable x 1 </br> ? User Manual x 1 </br> ? Extra Ear Caps x 2 </br> ? Cable Clip x 1 read more

Memorex

bluetooth headphones with deep bass sound for even the most discerning of audio aficionados pair with any bluetooth enabled audio ...source for personalized private listening enjoyment. use hands free microphone to pause music to take calls or not ... read more

JBL
¤79.95 ¤99.95
at Walmart.com

the jbl everest 100 brings you legendary sound in an on the go design. bluetooth 4.1 technology enables wireless connectivity jbl ...pro audio sound delivers a dynamic listening experience and ergonomic earpieces allow for unprecedented fit comfortable on... read more

JBL
Audio-Technica
¤180.99 ¤381.46
at Walmart.com

audio technica solid bass wireless over ear headphones with built in mic and control bluetooth wireless technology with mic and mu...sic and volume controls built into the earcup for answering ending calls controlling music and video playback and... read more

Hamilton and Buhl
¤286.99 ¤556.70
at BizChair

headphone holder rack with dust cover 1 wireless transmitter with built in blue tooth 4 wireless headphones 1 ac power adapter for... use with transmitter and headphone charging 1 6 way charging cables for wireless headphone charging range 300 feet 4... read more

Jabra
¤49.99 ¤129.99
at Walmart.com

free your workout with premium wireless sound exercise is about breaking free so dont let wires hold you back. powerful speakers d...eliver world class music performance. control music playback volume and take calls with a quick tap on the earbuds.... read more

Frontgate
¤399.99
at Frontgate

developed in conjunction with renowned french designer phillipe stark these revolutionary wireless headphones are the ultimate on ...the go musical companion. the parrot zik 3 headphones feature 32 bit audio processing to ensure music is heard in all its... read more

VisionTek
¤94.98 ¤129.98
at Dell.com

the sound tube pro delivers premium sound in an elegant portable wireless speaker. designed with left right channel stereo speaker...s as well as a built in active bass for immersive musical tonal character. never be tied down with wires that get in the... read more

JBL
¤34.99 ¤99.95
at Harman Audio

bask your ears in bold jbl sound large 40mm drivers with purebass performance envelop your ears delivering an expansive soundstage... with clarity and precision. bluetooth technology allows wireless connectivity with your smart devices with... read more

JBL
Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Plantronics
¤185.95
at Dell.com

the portable dect headset system includes a light headset on the market the savi 440. experience best in class pc sound quality wi...th a versatile headset that can be worn three ways to match your personal style. a hot swappable battery for unlimited... read more

LilGadgets
¤49.00 ¤64.95
at Walmart.com

lilgadgets untangled pro childrens premium bluetooth wireless headphone volume limited to 93db with 40mm drivers with 12 hour batt...ery life and 180 hour standby made of polycarbonate and stainless steel and covered in softtouch fabric sized padded... read more

Samsung
¤128.99 ¤337.38
at Walmart.com

these samsung level on headphones make an excellent gift for any audiophile. samsung level on pn 900 wireless noise canceling head...phones works with bluetooth enabled devices and devices with 3.5mm connectivity 40mm hd drivers active noise cancellation... read more

XO Vision
¤16.03 ¤38.52
at Walmart.com

the xo vision infrared wireless foldable headphone are the perfect accessory for the family on the go especially for the kids thes...e headphones are compatible with ir transmitters allowing backseat passengers to enjoy excellent sound clarity from... read more

samsung

ultra high quality audio uhqa technology delivers a true 24bit digital audio experience with up to 2x wider frequency range than s...tandard cd quality wireless sound. combined with noise isolating ear gels listeners experience vivid concert hall... read more

Satechi

details featuring advanced bluetooth 4.0 technology a luxurious design and premium sound the satechi aluminum wireless headphones ...allow you to listen to your music effortlessly and in style. connect via bluetooth or dont. aux cord included the... read more

Definitive Technology

over ear noise cancelling headphones bluetooth wireless operation with advanced aptx audio circuitry for streaming high quality st...ereo sound from compatible devices50mm drivers and built in dac deliver clear wide open soundactive noise cancellation... read more

Logitech
¤149.99
at Dell.com

the g533 wireless gaming headset features pro g audio drivers and surround sound technology with a long battery life. product type... headset 7.1 channel wireless recommended use game console computer headphones form factor full size connectivity... read more

Beats

on ear wireless headphones. connect via class 1 bluetooth with your device for wireless listening. integrated on ear controls and ...built in dual beam forming microphones. long hours of battery life for multi day use with fast fuel five minutes of... read more

Audiovox
¤45.51 ¤47.48
at Walmart.com

digital signal processinggeneral information manufacturer audiovox corporation manufacturer part number whp141b product name rca w...hp141 wireless headphone manufacturer website address www.audiovox.com product type headphone product model whp141... read more

SQDeal
¤25.99 ¤31.99
at Amazon.com

Cool Nice Bluetooth Headset with 3.0 wireless taansmission protocol,up to 10 meters range,you can enjoy high SNR stereo bluetooth ...wireless music <br> <br> Take your game experience to the next level with this wireless Bluetooth headset .Discuss gaming strategy with your teammates, trash-talk your opponents or just chat while playing your favorite games. <br> Immerse yourself in the complete gaming experience. <br> <br> Built-in high-performance rechargeable lithium battery,can be guaranteed only charge 2 hours to 12 hours of high SNR bluetooth wireless music enjoyment or hours talk time <br> <br> Wireless microphone design, you can via computer networks fun conversation with friends and relatives,to achieve a convenient and comfortable <br> <br> When you listen to music and then a telephone call,you headset wall automctically switch to the telephone answering mode,will not let you miss a call.After the end of call will automatically ,switch back to music playback. <br> <br> System requirements:audio equipments with bluetooth function ,including PC,Mobile ,MP3 MP4,notebook computer etc <br> <br>Compatiable with: <br> Samsung Galaxy S6 S5 S4 S3, iPhone 6 Plus, iPhone 6 5 5S 5C 5, iPad, iPad Air Mini 2 3 4 5, HTC, LG, Tablet PC, more ios android smartphone,PC Computer(need to support bluetooth function) <br> <br> <b>Note:This headset is NOT made by Sony! You can use the mic for chatting while playing games On PS3, can not hear game sounds. </b> <br> It Supports music play and calling function for cell phone, tablet, computer, MP3, MP4.PC <br> <br>Shipping: Please make sure your shipping address is current and correct when you order, ZIP CODE and APT# matters also. read more

Sony

From the biggest booms to the quietest whispers, you'll experience every detail of your favorite games in stunning high fidelity 7....1 virtual surround sound via the PlayStation.4/PlayStation.3/PlayStation. Vita/PC Gold Wireless Stereo Headset. Plus, keep the chatter coming through the hidden noise-canceling microphone, and get access to custom game modes created by developers exclusively for PlayStation. with the Headset Companion App. read more