Shop SoundAndVision
Refine By

Mpow Wireless Headphones

  • Sort By:
21.69 28.99

<b>Wireless Sport Headphones</b><br> <br> Specially designed for sports enthusiast, the perfect music partner for sports and<br> <br> <b>Robust & Dynamic Sound</b><br> <br> Adopt Bluetooth 4.1, this sports headphone offers incredible sound quality with deep extremely deep, distortion-free bass and truer sounds and delivers stable and strong signal than the general Bluetooth headset in a 32-feet working distance.<br> <br> <b>Handsfree Function</b><br> <br> This Bluetooth headset can provide the true hands-free convenience and exceptional ease-of-use, so that you you can get hands-free phone conversation with clear voice even in noisy environment like inside a gym and running/cycling on the road.<br> <br> <b>Metal-constructed Shell</b><br> <br> Featured with exquisite metal-constructed shell, this in-ear headphones is well-designed and high-end that can create the metal sound chamber.<br> <br> <b>Multipoint Function</b><br> <br> The three smart button in-line control with microphone allows you conveniently control your music-playing options and answer or end calls.<br> <br> <b>Package Includes:</b><br> <br> 1 x Mpow Coach Bluetooth Sport Headphone<br> 3 x Ear Tips(Small, Medium, Large)<br> 1 x Micro USB Charge Cable<br> 3 x Indoor Leisure Fit Ear Hooks<br> 3 x Outdoor Sport Fit Ear Hooks<br> 1 x User Manual read more


mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more


bluetooth 4.1 adopts bluetooth 4.1 this headphones connect to your phone or tablet up to 32 feet while ensuring robust and clear s...ound comfortable fit with ergonomic design and soft silicone ear hook this in ear bluetooth headphone fits... read more


mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

35.69 45.99

<p><b>Immersive Hi-Fi Sound</b></p> <p>Designed for an excellent listening experience, Mpow Bluetooth headset with CSR chip and ar...ound-ear cushion design can provide robust, immersive and Hi-fidelity sound.</p> <p><b>Advanced Compatibility</b></p> <p>The Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. </p> <p><b>Dual mode: Wireless & Wired</b></p> <p>In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; <br> In the wired mode: Used as a wired headphone with an audio cable.</p> <p><b>Note: </b></p> <p>1. Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. <br>2. The microphone only works in the wireless mode. </p> <p><b>Specification</b></p> <p>Bluetooth Version: 4.0<br> Range: 33 feet (10 meters)<br> Talking Time: Around 15 hours<br> Playback Time: Around 13 hours<br> Charging Time: 4 hours<br> Charging Voltage: 5V<br> Battery Capacity: 420mAh<br> </p> <p><b>Packing List</b></p> <p>1x Mpow Bluetooth Headset<br> 1x 3.5mm Audio Cable<br> 1x USB Charging Cable<br> 1x Packing Bag<br> 1x User Manual<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45-day money back & 18-month warranty.</p> read more

23.69 29.99

<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters... out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. Noise cancelling microphone further guarantees clear sound for hands-free calls.</p> <p><b>Wireless Freedom</b></p> <p>With a battery life of 8 hours continuous wireless playback, our product won't let you down. However, if you do find yourself unable to recharge, you have the option of using the included audio cable(Wired mode without microphone). The headphone is optimized for portable audio including mp3, CD players, iPad, iPod iPhone, and other Bluetooth mobile devices.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes the headphone easy to take along on vacation or business trip. You can store it in your bag for use at work when you need to focus. </p> <p><b>Wearing Comfort</b></p> <p>Super soft ear cushions help lock your ear snugly and the ultra-light weight of the overhead headphone does not cause any burden to the ears, thus providing lasting wearing comfort.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

25.69 35.99

<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with CVC6.0 noise cancellation technology, the headphone intelligently ...filters out background noise for perfect speech transmission in busy and noisy environments. Compared to Bluetooth 4.0, the latest Bluetooth 4.1 technology features faster & stable signal transmission, clearer sound quality and lower power consumption.</p> <p><b>Stylish & Versatile Shark Design</b></p> <p>With the built-in intelligent magnet design, you can easily trim the earplug cables when you don?t need them and hang the headphone like a necklace around your neck. Prevents troublesome wires from tangling and provides a natural feel through all-day wear.</p> <p><b>Easy Button Control</b></p> <p>Unlike ordinary Bluetooth earbuds for running and workouts, this comfort-fit earbuds allows for easy and accurate one-touch control located on the neckband, no need to take off the earbuds.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headset allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Notice:</b></p> <p>To protect the earbud cable against the damage of pulling force, please pinch the earplugs instead of the cables when pulling earplugs out of the shark-like magnet which can ganrantee the lifespan of earbuds by using it in the right way.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more