Shop SoundAndVision
Refine By
Mpow
22.99 25.99
at Amazon.com

With the latest Bluetooth 4.1 technology and the advanced CSR chip, our sports earphones are dedicated to provide superb sound qua...lity experience. Stylish ear hooks fit well to your ears for worry-free exercising. <p><b>Premium Sound Quality</b></p> <p>Adopted innovative A2DP technology, Bluetooth earphones allow you to enjoy clear and natural sound when running.</p> <p><b>Stable Bluetooth Signal</b></p> <p>Bluetooth 4.1 technology features faster and more stable signal transmission, high sound quality and low energy consumption. Support two Bluetooth mobile phones pairing simultaneously. </p> <p><b>Lightweight and Comfortable</b></p> <p>Our lightweight earphones come with ergonomic designed ear hooks that provide comfortable wearing without falling out easily. The ear tips ensure a good seal in the ear that minimizes the outside distractions and makes you focused on the things that matter.</p> <p><b>Hassle-free Calling</b></p> <p>Built-in HD microphone transmits crystal clear voice for hassle-free conversations. You can easily control multifunction like music and calls via the button on the Bluetooth earphones.</p> <p><b>Long Battery Life</b></p> <p>Improved lithium battery ensures up to 7 hours talking time, 6 hours music time and up to 160 hours stand-by time. </p> <p><b>Warranty</b></p> <p>The product includes a 45 days money back & 18-month warranty.</p> <p><b>Specifications:</b></p> <p>Bluetooth Version: V4.1<br> Bluetooth Profiles: Headset, Handsfree, A2DP, AVRCP<br> Charging Port: Micro USB<br> Standby Time: up to 160 Hours<br> Talk Time: up to 7 Hours<br> Playing Time: up to 6 Hours<br> Weight: 1.2oz<br> </p> <p><b>Package Included:</b></p> <p>1 Bluetooth Sports Earphones<br> 1 USB Charging Cable<br> 3 Different Sizes Ear Tips (Small/Medium/Big)<br> 1 User Manual<br> </p> read more

Mpow

bluetooth 4.1 adopts bluetooth 4.1 this headphones connect to your phone or tablet up to 32 feet while ensuring robust and clear s...ound comfortable fit with ergonomic design and soft silicone ear hook this in ear bluetooth headphone fits... read more

Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Mpow

mpow brand certified top brand bluetooth accessories for smartphones.cheetahs stylish behind ear streamline outlook design guarant...ee 100 stable and comfortable user wearing experience for runningjoggingbikingdrivingfishingcampinghiking and... read more

Mpow
42.99 52.99
at Amazon.com

<p><b>Humanized Working Modes</b></p> <p>Dual Channel Mode: Both two earbuds work when listening to the music,and the true cable-f...ree design allows you to share music with your friends by using the earbuds separately. two earbuds should be used less than 16-32 ft apart.<br> <br>Mono Channel Mode: To protect your privacy, only the right earbud can work when there is a phone call, so please take the right earbud as the main earbud for yourself.</p> <p><b>Warranty</b></p> <p>Every MPOW product provides a 45-day money back guarantee and 18-month warranty.</p> <p><b>How to pair: </b></p> <p>1. Turn on the Bluetooth function on your phone;<br> 2. Long press the Multi-Function Button on the main earbud (R) till it alternately flashes red and blue, Choose MPOW-058 on your phone and pair;<br> 4. Press the multifunction button of the L earbud for about 2 seconds to turn it on then the L will connect to the R automatically after a "beep". <p><b>"True Wireless" Working Principle You Need to Know?</b></p> <p>Usually, the R earbud get the Bluetooth signal from your device (lose 20% signal on the way) and transmit it to the L earbud?lose 20% again), as a result, the L earbud can get only 60% Bluetooth signal from the original device, that is why all the true wireless earbuds on the market always have the same problem of connection on the left earbud. FORTUNATELY, We have already made some improvements on Mpow-058, our L earbud can get 75% of the initial Bluetooth signal. HOWEVER, The quality and strength of Bluetooth signal from your Blutooth devices can still affect a lot on the perfomance of all the true wireless earbuds, please try another device if you have any problem with the connnetion. ( iPhone 6 7 series will be recommended according to the siganl test) </p> read more

Mpow
34.69 45.99
at Amazon.com

<p><b>Immersive Hi-Fi Sound</b></p> <p>Designed for an excellent listening experience, Mpow Bluetooth headset with CSR chip and ar...ound-ear cushion design can provide robust, immersive and Hi-fidelity sound.</p> <p><b>Advanced Compatibility</b></p> <p>The Bluetooth headset can easily and quickly connect with smartphones, tablets, TVs and other Bluetooth devices within 33 feet, bringing you crystal clear sound effect. PLEASE make sure the driver software of receiving adapter is fully updated when connected to PC or laptop, and you need a SEPARATE Bluetooth adapter when connected with TV.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes it easy to store them when not in use or during travels. The stainless steel slider headband allows you to find the perfect fit and provide excellent durability. </p> <p><b>Dual mode: Wireless & Wired</b></p> <p>In the wireless mode: With a built-in 420mAh battery which provides 13 hours' continuous wireless playback and let you get rid of the tangled cables on the move; <br> In the wired mode: Used as a wired headphone with an audio cable.</p> <p><b>Note: </b></p> <p>1. Please keep the headset in dry and cool environment as the earmuff is made of memory-protein materials. <br>2. The microphone only works in the wireless mode. </p> <p><b>Specification</b></p> <p>Bluetooth Version: 4.0<br> Range: 33 feet (10 meters)<br> Talking Time: Around 15 hours<br> Playback Time: Around 13 hours<br> Charging Time: 4 hours<br> Charging Voltage: 5V<br> Battery Capacity: 420mAh<br> </p> <p><b>Packing List</b></p> <p>1x Mpow Bluetooth Headset<br> 1x 3.5mm Audio Cable<br> 1x USB Charging Cable<br> 1x Packing Bag<br> 1x User Manual<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45-day money back & 18-month warranty.</p> read more

Mpow

<p><b>Sound Leadership & Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters... out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. Noise cancelling microphone further guarantees clear sound for hands-free calls.</p> <p><b>Wireless Freedom</b></p> <p>With a battery life of 8 hours continuous wireless playback, our product won't let you down. However, if you do find yourself unable to recharge, you have the option of using the included audio cable(Wired mode without microphone). The headphone is optimized for portable audio including mp3, CD players, iPad, iPod iPhone, and other Bluetooth mobile devices.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Foldable and Portable Design</b></p> <p>The foldable design makes the headphone easy to take along on vacation or business trip. You can store it in your bag for use at work when you need to focus. </p> <p><b>Wearing Comfort</b></p> <p>Super soft ear cushions help lock your ear snugly and the ultra-light weight of the overhead headphone does not cause any burden to the ears, thus providing lasting wearing comfort.</p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more

Mpow

<p><b>Mpow Enchanter Bluetooth Earbuds</b></p> <p><b> </b></p> <p><b>Sound Leadership</b></p> <p>The latest Bluetooth 4.1 technolo...gy and best CSR chip provide strong signal quickly and easily connecting, giving these wireless earbuds robust stereo sound quality.</p> <p><b>Voice Clarity</b></p> <p>Featured with noise cancellation technology, the headphone intelligently filters out background noise for perfect speech transmission in busy and noisy environments and reduces background noise, such as car road noise and air conditioning fans for clearer sound. 3 pairs of ear cups are supplied which isolate ambient noise well when listening to music. </p> <p><b>Designed for Sports</b></p> <p>No worry for sweat out any more, the circuit board inside earphone is coated with sweat-proof and corrosion-resistant nano-material, which greatly protects sport headphones from sweat and water.</p> <p><b>Hands Free Calling</b></p> <p>Now you do not have to stop what you are doing at hand to answer a call. The wireless Bluetooth headphone allows auto switching between music and calls. You can control all functions of music and calls easily via the buttons on the headset. Enjoy a cheerful chat with your friends while you are doing your office work, housework, gardening, or particularly when you are driving along the fast lane.</p> <p><b>Product Specification</b></p> <p>Bluetooth Version: V4.1<br> Charging Time: ?2 hours<br> Standby Time: 400 Hours<br> Play Time: 6 Hours<br> Talk Time: 7 Hours<br> Bluetooth Profile: AVRCP/A2DP/HSP/HFP<br> Battery: 3.7V / 100mAh<br> </p> <p><b>Warranty</b></p> <p>Every Mpow product includes a 45 days money back & 18-month warranty.</p> read more